DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and AT5G22400

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_197632.1 Gene:AT5G22400 / 832301 AraportID:AT5G22400 Length:466 Species:Arabidopsis thaliana


Alignment Length:314 Identity:85/314 - (27%)
Similarity:147/314 - (46%) Gaps:43/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1010 ASLPQQQLRDELYVQLCRQTTENPKRDSLIRGWE----LMAICLSYVPPSPTFQPTLLNYVNRHR 1070
            ||:.:|.||.       |.:|:..:.|.   |.|    |:|:.::      .|:.:|::..:..|
plant    62 ASIEEQDLRR-------RSSTDGGEEDD---GGEDQISLLALLVA------IFRRSLISCKSNRR 110

  Fly  1071 DPSFATCFMEVSKWPIHVQISHYATVCCRRLDRIGSSGRRMAKKPTVDEVEQARQQILRNSMFGN 1135
            :    .|.||:. ||.:|:  |.|.|...|.:  |..|..:..:|.|..    |......::|| 
plant   111 E----LCSMEIG-WPTNVR--HVAHVTFDRFN--GFLGLPVEFEPEVPR----RAPSASATVFG- 161

  Fly  1136 TLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLDRWDVPDY 1200
            ..:|.|.|..:. ....:|.|...:...:....|.|.|||||::|:..|...::.:|:|..:|: 
plant   162 VSTESMQLSYDS-RGNCVPTILLLMQNCLYSQGGLQAEGIFRLTAENSEEEAVREQLNRGFIPE- 224

  Fly  1201 KNTLVDAHTPASLLKLWYRELYDPLIPDAYYEDCVNTEDPDKAKEIVNKLPEINQLVLTYLIHFL 1265
               .:|.|..|.|:|.|:|||...::.....|..:..:..::..|:|..||.....:|.:.|:.:
plant   225 ---RIDVHCLAGLIKAWFRELPTSVLDSLSPEQVMQCQTEEENVELVRLLPPTEAALLDWAINLM 286

  Fly  1266 QQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSEDPKVILENARKEMSFMRTLIQ 1319
            ..  :.:.....||:|.|:|||||||..:  .:||...|..|.:.|:|::|||:
plant   287 AD--VVQYEHLNKMNSRNIAMVFAPNMTQ--MDDPLTALMYAVQVMNFLKTLIE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 29/115 (25%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 55/187 (29%)
AT5G22400NP_197632.1 CRIB 115..155 CDD:238077 14/48 (29%)
RhoGAP 178..337 CDD:214618 50/167 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3184
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.