DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and AT4G03100

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_192219.2 Gene:AT4G03100 / 828092 AraportID:AT4G03100 Length:430 Species:Arabidopsis thaliana


Alignment Length:261 Identity:73/261 - (27%)
Similarity:121/261 - (46%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1067 NRHRDP------SFATCFMEVSKWPIHVQ-ISHYATVCCRRLDRI-GSSGRRMAKKPTVDEVE-Q 1122
            ||..|.      |.|...||:. ||.:|: |:|..      .||. |..|     .|...:|| .
plant    60 NRQDDGGVGGGISSAVHHMEIG-WPTNVRHITHVT------FDRFHGFLG-----LPHELQVEIP 112

  Fly  1123 ARQQILRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGC 1187
            .|......|:||.:...:.....||  ...:|.|...:.|.:....|.:.|||||::.:..:...
plant   113 CRVPSASVSVFGVSAESMQCSYDEK--GNSVPTILLLMQERLYSQQGLKAEGIFRINPENSQEEH 175

  Fly  1188 MKNRLDRWDVPDYKNTLVDAHTPASLLKLWYRELYDPLIPDAYYEDCVNTEDPDKAKEIVNKLPE 1252
            ::::|:|..||:.    :|.|..|.|:|.|:|||...::.....|:.:|....|::.|::.:|..
plant   176 VRDQLNRGIVPEN----IDVHCLAGLIKAWFRELPSGVLDGLSPEEVLNCNTEDESVELIKQLKP 236

  Fly  1253 INQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSEDPKVILENARKEMSFMRTL 1317
            ....:|.:.:..:..  :.|.....||::.|:|||||||..:.|  ||...|.:|.:.|:.::||
plant   237 TESALLNWAVDLMAD--VVEEEESNKMNARNIAMVFAPNMTQMT--DPLTALMHAVQVMNLLKTL 297

  Fly  1318 I 1318
            |
plant   298 I 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 19/63 (30%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 52/186 (28%)
AT4G03100NP_192219.2 PBD 80..113 CDD:197628 12/44 (27%)
RhoGAP 140..298 CDD:214618 46/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3184
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.