DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and ROPGAP3

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_850458.1 Gene:ROPGAP3 / 819283 AraportID:AT2G46710 Length:455 Species:Arabidopsis thaliana


Alignment Length:259 Identity:71/259 - (27%)
Similarity:113/259 - (43%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 TCFMEVSK----------WPIHVQ-ISHYATVCCRRLDRI-GSSGRRMAKKPTVDEVEQARQQIL 1128
            :|.||..:          ||..|: :||..      .||. |..|.....:|.|    ..|....
plant    89 SCAMERGEDDVVASMDIGWPTEVKHVSHVT------FDRFNGFLGLPSELEPEV----PPRAPSA 143

  Fly  1129 RNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLD 1193
            ..|:||.:...:.....::  ...:|.|...:.:.:....|.:.|||||::.|..:...::.:|:
plant   144 SVSVFGVSAKSMQCSYDDR--GNSVPTILLRMQKRLYTEGGLKAEGIFRINPDNGKEEHVRRQLN 206

  Fly  1194 RWDVPDYKNTLVDAHTPASLLKLWYREL----YDPLIPDAYYEDCVNTEDPDKAKEIVNKLPEIN 1254
            ...||    ..:|.|..|.|:|.|:|||    .|.|.|:.... | |||  :....:|..||.:.
plant   207 CGVVP----RGIDVHCLAGLIKAWFRELPTGVLDVLTPEQVMR-C-NTE--EDCSRLVILLPPVE 263

  Fly  1255 QLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSEDPKVILENARKEMSFMRTLI 1318
            ..:|.:.|..:..  :.|.....||::.|:|||||||..:..  ||...|.:|.:.|:|::|||
plant   264 SAILDWAIGLMAD--VVEHEQFNKMNARNVAMVFAPNMTQMA--DPLTALIHAVQVMNFLKTLI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 14/57 (25%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 55/190 (29%)
ROPGAP3NP_850458.1 CRIB 103..143 CDD:238077 12/49 (24%)
RhoGAP 167..323 CDD:238090 51/167 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3184
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.