DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and Y92H12BL.7

DIOPT Version :10

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001364505.1 Gene:Y92H12BL.7 / 43578496 WormBaseID:WBGene00305050 Length:175 Species:Caenorhabditis elegans


Alignment Length:156 Identity:77/156 - (49%)
Similarity:101/156 - (64%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1141 MDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLDRWDVPDYKNTLV 1205
            |.:|.||||..||||:.|||.|.:....|::|||:|||:.|.:::...:.:||.|..|    .:.
 Worm     1 MQMQSEKFPELKLPWLLTTLIELLYQSGGRRTEGLFRVAGDPEQLATARGQLDGWLAP----KMH 61

  Fly  1206 DAHTPASLLKLWYRELYDPLI-PDAYYEDCVNTEDPDKAKEIVNKLPEINQLVLTYLIHFLQQFA 1269
            ||:.||.|||||.|:|..||| |..|....|..|:|.:|..:|:.|||||:|||..:|..||..:
 Worm    62 DANVPAGLLKLWLRQLPVPLILPTLYQRALVAAENPAEAIRLVDLLPEINRLVLVRVIALLQDLS 126

  Fly  1270 IPEVVSCTKMDSSNLAMVFAPNCLRC 1295
            ..|||:.||||:||||||.|||.|||
 Worm   127 REEVVAKTKMDTSNLAMVIAPNILRC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 PRP40 1..>75 CDD:227435
PAT1 <737..>892 CDD:401645
MyTH4 1004..1122 CDD:459939
RhoGAP_KIAA1688 1133..1320 CDD:239854 77/156 (49%)
Y92H12BL.7NP_001364505.1 RhoGAP 1..162 CDD:470621 77/156 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.