DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and Arhgap24

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_038947750.1 Gene:Arhgap24 / 305156 RGDID:1306669 Length:815 Species:Rattus norvegicus


Alignment Length:218 Identity:69/218 - (31%)
Similarity:105/218 - (48%) Gaps:19/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 DEVEQARQQI---LRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVS 1179
            |.|:..|:.|   ....:||..|.:.:..:| ::..|..|.:.....:.: ...|.:.||:||:.
  Rat   181 DWVKSIRRVIWGPFGGGIFGQKLEDTVRYEK-RYGNRLAPMLVEQCVDFI-RQRGLKEEGLFRLP 243

  Fly  1180 ADVDEVGCMKNRLDRWDVPDY-KNTLVDAHTPASLLKLWYRELYDPLIPDAYYED---C---VNT 1237
            ...:.|..:::..|..:.|.: .||  |.||.||||||:.|||.:|::|.|.|||   |   ::.
  Rat   244 GQANLVKELQDAFDCGEKPSFDSNT--DVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSK 306

  Fly  1238 EDPDKAKEI---VNKLPEINQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSED 1299
            |:....||:   |..||.:|..:|.|:..||.:  :.......||.:.|||.||.||.||...||
  Rat   307 EEEAGVKELTKQVKSLPVVNYNLLKYICRFLDE--VQSYSGVNKMSAQNLATVFGPNILRPKVED 369

  Fly  1300 PKVILENARKEMSFMRTLIQHMD 1322
            |..|:|........|..:|...|
  Rat   370 PLTIMEGTVVVQQLMSVMISKHD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 2/3 (67%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 64/196 (33%)
Arhgap24XP_038947750.1 PH_RhoGap24 84..197 CDD:241530 4/15 (27%)
RhoGAP_ARHGAP22_24_25 197..395 CDD:239855 65/202 (32%)
Smc <716..>802 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.