DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and arhgap24

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_001339010.2 Gene:arhgap24 / 100005116 ZFINID:ZDB-GENE-091118-20 Length:752 Species:Danio rerio


Alignment Length:236 Identity:71/236 - (30%)
Similarity:107/236 - (45%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 DEVEQARQQI---LRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLN-GKQTEGIFRV 1178
            |.|:..|:.|   ....:||..|.|.:..:: ::..:..|.:.....:  .:.| |.:.||:||:
Zfish   118 DWVKSIRRVIWAPFGGGIFGQKLEETVRYER-RYGNKMAPMLVEQCVD--FIRNWGLREEGLFRL 179

  Fly  1179 SADVDEVGCMKNRLDRWDVPDYK-NTLVDAHTPASLLKLWYRELYDPLIPDAYYED---CVNTED 1239
            ....:.|..:::..|..:.|.:. ||  |.||.||||||:.|||.:|:||.:.||:   |.....
Zfish   180 PGQANLVKELQDAFDCGEKPSFDCNT--DVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLS 242

  Fly  1240 PDK---AKEI---VNKLPEINQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSE 1298
            .|:   .||:   |..||.:|..:|.|:..||.:  :.......||...|||.||.||.||...|
Zfish   243 KDQEAGMKELRRQVEALPVVNYNLLKYICKFLDE--VQSYSGVNKMSVQNLATVFGPNILRPKVE 305

  Fly  1299 DPKVILENARKEMSFMRTLI-----------QHMDTTHVAN 1328
            ||..|:|........|..||           :|..|..:.|
Zfish   306 DPVTIMEGTVLVQQLMAVLIGQHDVLFPAEEEHSSTLELVN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 2/3 (67%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 64/208 (31%)
arhgap24XP_001339010.2 PH-like 21..134 CDD:302622 4/15 (27%)
PH 23..127 CDD:278594 3/8 (38%)
RhoGAP_ARHGAP22_24_25 134..332 CDD:239855 64/204 (31%)
BAR <649..737 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.