DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and YHP1

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:63/292 - (21%)
Similarity:105/292 - (35%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIATKSSKAAFSIENILEQKSSSHRSQSRRGSSQSPVAVTAGIA--------TPHALAMPKASLA 58
            :|.|.:|.:.|.:..:   .:::..|..:......|:|.:|.|.        :|.....||..  
Yeast    13 NIITGTSNSPFQLHTL---PNTNFPSDDQGDIRLPPLAASAHIVRPVVNIYKSPCDEERPKRK-- 72

  Fly    59 TGSSSAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQ 123
              |..|....|....|::..||:.        |.:.|.:...||....:...|..:...|::|  
Yeast    73 --SPQAVDFLSQRVTTSMTPLSKP--------KKLSSHSPFTPTVRVCSKEQPPQSMHSYKKV-- 125

  Fly   124 LQKNPSLFMPHFQAAAVAAAAAVQPTAYCDQYSPF---TMDCEGFP--NPASAAAALYCNAYPAA 183
                 ::..|     ..||.|.:.||...::...|   |...|.||  .|....|.|        
Yeast   126 -----NILTP-----LSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARL-------- 172

  Fly   184 SFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
                    .:||  :.|.:|.:...|:..|......:..:|..|:.|..::::.|:.||||:|  
Yeast   173 --------ARRK--RRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKR-- 225

  Fly   249 WRRANLSKRSASAQGPIAGAAVGSPSSASSSS 280
             :.|...|.|    |..:...|.|..|.|..|
Yeast   226 -QAAKKHKNS----GNTSHCKVHSNDSMSMIS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 13/49 (27%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24324
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.