DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and PHO2

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:28/96 - (29%)
Similarity:47/96 - (48%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRR 246
            :||...|:.|.:|. .:.|...:....|:.:|..:...|..||:.::..:.:.::.|:.||||||
Yeast    66 SASSNASDSGPQRP-KRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRR 129

  Fly   247 AKWRRANLSKRSASAQGPIAGAAVGSPSSAS 277
            ||.|:    |:..|.:..|       |||.|
Yeast   130 AKLRK----KQHGSNKDTI-------PSSQS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 15/49 (31%)
PHO2NP_010177.1 COG5576 53..183 CDD:227863 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.