DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and ATHB13

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:69 Identity:28/69 - (40%)
Similarity:35/69 - (50%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRA 252
            |..|.|::    |...:|.|.||..|.....|.||.:..||..|.|..||:..|||||||:|:..
plant    80 SQMGEKKR----RLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTK 140

  Fly   253 NLSK 256
            .|.|
plant   141 QLEK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 22/49 (45%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 23/56 (41%)
HALZ 140..182 CDD:396657 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.