powered by:
Protein Alignment HHEX and ATHB13
DIOPT Version :9
Sequence 1: | NP_650938.2 |
Gene: | HHEX / 42495 |
FlyBaseID: | FBgn0038852 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177136.1 |
Gene: | ATHB13 / 843314 |
AraportID: | AT1G69780 |
Length: | 294 |
Species: | Arabidopsis thaliana |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 35/69 - (50%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 188 SNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRA 252
|..|.|:: |...:|.|.||..|.....|.||.:..||..|.|..||:..|||||||:|:..
plant 80 SQMGEKKR----RLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTK 140
Fly 253 NLSK 256
.|.|
plant 141 QLEK 144
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0483 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.