DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and AT1G61200

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_176315.1 Gene:AT1G61200 / 842413 AraportID:AT1G61200 Length:71 Species:Arabidopsis thaliana


Alignment Length:96 Identity:30/96 - (31%)
Similarity:38/96 - (39%) Gaps:32/96 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RILA-FGAEP---GPSGL--GPKLPNGMAKVNSLSESDTLED--------EDDDEEEEDDAE--- 335
            |||| .||.|   ...||  .|:.|..:|||.|..|   ||:        ..|...|..|.|   
plant   187 RILALLGALPCFIQVIGLFFVPESPRWLAKVGSDKE---LENSLLRLRGGNADISREASDIEVMT 248

  Fly   336 ---EDDDTGAGRGANRFAKL---KYRDSIMV 360
               |:|...:      |..|   |||.:::|
plant   249 KMVENDSKSS------FCDLFQRKYRYTLVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649
AT1G61200NP_176315.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.