DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HAT2

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:121 Identity:32/121 - (26%)
Similarity:51/121 - (42%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PFTMDCE---GFPNPASAAAAL---------------------YCNAYPAASFYMSNFGVKRKGG 197
            |.|::||   |..:|.|..::.                     :....|...:.......:..||
plant    61 PSTVNCEEDTGVSSPNSTISSTISGKRSEREGISGTGVGSGDDHDEITPDRGYSRGTSDEEEDGG 125

  Fly   198 Q-----IRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
            :     :|.:..|:..||..|.....|:|:::..||.:|.||.|||:.|||||||:
plant   126 ETSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRAR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 22/49 (45%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:461370 7/29 (24%)
HOX 129..183 CDD:197696 22/53 (42%)
HALZ 185..228 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.