DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HB-3

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:66 Identity:26/66 - (39%)
Similarity:34/66 - (51%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLS 255
            |.|:|    |...:|.:.||..|.....|.||.:..||..|.|..||:..|||||||:|:...|.
plant   113 GEKKK----RLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLE 173

  Fly   256 K 256
            :
plant   174 R 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 22/50 (44%)
HB-3NP_568309.2 Homeodomain 115..168 CDD:459649 23/56 (41%)
HALZ 170..208 CDD:460477 1/5 (20%)

Return to query results.
Submit another query.