| Sequence 1: | NP_650938.2 | Gene: | HHEX / 42495 | FlyBaseID: | FBgn0038852 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195493.1 | Gene: | HAT22 / 829935 | AraportID: | AT4G37790 | Length: | 278 | Species: | Arabidopsis thaliana |
| Alignment Length: | 51 | Identity: | 24/51 - (47%) |
|---|---|---|---|
| Similarity: | 34/51 - (66%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 198 QIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HHEX | NP_650938.2 | Homeodomain | 200..251 | CDD:459649 | 24/49 (49%) |
| HAT22 | NP_195493.1 | Homeodomain | 125..179 | CDD:459649 | 24/51 (47%) |
| HALZ | 181..224 | CDD:128634 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||