DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HAT22

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:51 Identity:24/51 - (47%)
Similarity:34/51 - (66%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 QIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
            ::|.|.||:..||..|.....|:|::::.||.||.|..|||:.|||||||:
plant   127 KLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 24/49 (49%)
HAT22NP_195493.1 Homeodomain 125..179 CDD:459649 24/51 (47%)
HALZ 181..224 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.