powered by:
Protein Alignment HHEX and HB20
DIOPT Version :9
Sequence 1: | NP_650938.2 |
Gene: | HHEX / 42495 |
FlyBaseID: | FBgn0038852 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_186771.1 |
Gene: | HB20 / 821232 |
AraportID: | AT3G01220 |
Length: | 286 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 26/66 - (39%) |
Similarity: | 34/66 - (51%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 GVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLS 255
|.|:| |...:|.|.||..|.....|.||.:..||..|.:..||:..|||||||:|:...|.
plant 85 GEKKK----RLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLE 145
Fly 256 K 256
:
plant 146 R 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0483 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.