DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and lbx2

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:151 Identity:51/151 - (33%)
Similarity:68/151 - (45%) Gaps:46/151 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKR 257
            ||:..:..||:.|...||.||...|||||.:|..:|.||.||:.||.|||||||||.:| :|.:.
Zfish   125 KRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKR-DLEEM 188

  Fly   258 SASAQ--------------------------GPIAGAAV--GSPSSASSSSVPVLNLGSGSRCGQ 294
            .|..:                          |||:.:..  ..|.|.|||.            ||
Zfish   189 KADVESLKKIPPQALQKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPSSSR------------GQ 241

  Fly   295 QSDEEDRMYLSEDDEDDDEDE 315
            .:||     .||:||:.:.|:
Zfish   242 TTDE-----FSEEDEEIEVDD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 29/50 (58%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.