DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and Barhl1

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_062319.1 Gene:Barhl1 / 54422 MGIID:1859288 Length:327 Species:Mus musculus


Alignment Length:168 Identity:39/168 - (23%)
Similarity:59/168 - (35%) Gaps:60/168 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RKRRTHCHHGYIKLKSV----EY-----IKPNNPAPALDRILA----------FGAEPGPSGLGP 303
            |:|...|.   :|:...    ||     :.|.|.:..:.|:.|          .|.:.|||    
Mouse    36 RERLKFCQ---LKISKAQTDEEYTDDDALIPKNTSVIIRRVPAAGLKSSNRRFVGHQAGPS---- 93

  Fly   304 KLPNGMAKVNSLSESDTLEDED---DDEEEEDDAEEDDDTGAGRGANRFAKLKYRDSIMVKTSNG 365
                  ||.:...:|..|..|.   .:...|..|.|:|            |||   ::|.::|..
Mouse    94 ------AKSSQTGDSSLLSLEQLLKTENLAEAKASEED------------KLK---AVMYQSSLC 137

  Fly   366 VYGKRPQSQLLLANA-----GVPSTS----TSSTSPPS 394
            .|..| .:.||..:|     |.|:.|    |:.|...|
Mouse   138 YYSSR-AAALLRKSASGGAQGFPAASCWRWTTQTERES 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649
Barhl1NP_062319.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 11/56 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 20/78 (26%)
Homeodomain 179..235 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.