DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and hhex

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_989420.1 Gene:hhex / 395060 XenbaseID:XB-GENE-487159 Length:274 Species:Xenopus tropicalis


Alignment Length:46 Identity:13/46 - (28%)
Similarity:21/46 - (45%) Gaps:9/46 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 EGYYSDDESEGT--DHKLSMYRGQG------GGGPGGSGKLRHQQH 482
            ||:|:.......  |:|.::. |:|      ||..|...:.:||.|
 Frog    34 EGFYTTGAVRQIFGDYKTTIC-GKGLSATVTGGQKGRGSRGQHQAH 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649
hhexNP_989420.1 Homeodomain 138..196 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..274
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.