DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and hoxb9a

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_571196.2 Gene:hoxb9a / 30344 ZFINID:ZDB-GENE-990415-109 Length:249 Species:Danio rerio


Alignment Length:73 Identity:28/73 - (38%)
Similarity:42/73 - (57%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNR 245
            |:|::..:....|::   ..:|..||..||..|..:.||:.:.|..:|..|.||:||||.|||||
Zfish   174 PSANWLHARSSRKKR---CPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNR 235

  Fly   246 RAKWRRAN 253
            |.|.::.|
Zfish   236 RMKMKKMN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 24/50 (48%)
hoxb9aNP_571196.2 Hox9_act 1..171 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..182 2/7 (29%)
Homeodomain 185..241 CDD:459649 25/58 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.