DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and ALX3

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:263 Identity:64/263 - (24%)
Similarity:102/263 - (38%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKASLATGSSSAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRF------NPIYP 111
            |...:|:|.....|..:|::|.:::                 .:....|...||      .|..|
Human    15 PGPYVASGDEPPGPQGTPAAAPHLH-----------------PAPPRGPRLTRFPACGPLEPYLP 62

  Fly   112 DPASLFYQQVLQLQKNPSLFMPHFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFP---------N 167
            :||....:.:..|...|:|...||..   ..|.|.:.|:....:....:||.|.|         :
Human    63 EPAKPPAKYLQDLGPGPALNGGHFYE---GPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGS 124

  Fly   168 PASAAAALYCNAYPAA--SFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQ 230
            |....|:|:....|..  |..::....|::..:..|::.|.:.||..|..:.|.....|..|||:
Human   125 PGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALR 189

  Fly   231 LKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSSVPVLNL-----GSGS 290
            ..||:.:|:.||||||||||:.....:....:.|...|...|....:.|...:.|.     ||||
Human   190 TDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWASPGSGS 254

  Fly   291 RCG 293
            ..|
Human   255 PGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 21/49 (43%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 21/108 (19%)
PRK12323 <13..131 CDD:237057 26/135 (19%)
Homeobox 157..210 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.