DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and Pitx2

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001035967.1 Gene:Pitx2 / 18741 MGIID:109340 Length:324 Species:Mus musculus


Alignment Length:115 Identity:34/115 - (29%)
Similarity:56/115 - (48%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKR 257
            :::..:..|||||.:.|||.|..::|.....|..:|:...||:.:|:.||:|||||||:...:::
Mouse    91 RQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQ 155

  Fly   258 SASAQ---GPIAG------------------AAVG-SPSSASSSSVPVLN 285
            :...:   ||...                  ||.| :.:|.|:.|.|..|
Mouse   156 AELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 23/50 (46%)
Pitx2NP_001035967.1 Homeodomain 93..149 CDD:459649 23/55 (42%)
OAR 282..299 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.