DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and DLX4

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:89 Identity:21/89 - (23%)
Similarity:34/89 - (38%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 KRPQSQLLLANAGVPSTSTSSTSPPSSEY-------DYAYITAINTHQPLSVMRSAGGDEAP--- 423
            :.|.:..|.....:.|::|:.:..|||..       |..  |.:..|..||:...:......   
Human    44 QEPNALFLSWKGPIMSSNTTISIHPSSALAIELKPEDQG--TTLRCHLKLSLDNLSSSKVVKLQL 106

  Fly   424 VSTTVLPDY-CI--TTICCPIEVH 444
            ||.|.|.:| |:  .|:.|....|
Human   107 VSPTRLLNYSCLLKRTLTCSCSFH 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 11/41 (27%)
Homeodomain 118..174 CDD:459649 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.