| Sequence 1: | NP_650938.2 | Gene: | HHEX / 42495 | FlyBaseID: | FBgn0038852 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_004913406.1 | Gene: | alx4 / 100493396 | XenbaseID: | XB-GENE-853003 | Length: | 376 | Species: | Xenopus tropicalis |
| Alignment Length: | 156 | Identity: | 48/156 - (30%) |
|---|---|---|---|
| Similarity: | 60/156 - (38%) | Gaps: | 54/156 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 188 SNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWR-- 250
Fly 251 ---------RANLS-----------KRSASAQGP--IAGAAVGSP-----------SSASSS--- 279
Fly 280 -----------SVPVLNLGSGSRCGQ 294 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HHEX | NP_650938.2 | Homeodomain | 200..251 | CDD:459649 | 24/61 (39%) |
| alx4 | XP_004913406.1 | COG5576 | 120..266 | CDD:227863 | 31/90 (34%) |
| Homeodomain | 182..238 | CDD:459649 | 24/56 (43%) | ||
| OAR | 352..370 | CDD:461067 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||