DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and hoxc3

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:135 Identity:42/135 - (31%)
Similarity:59/135 - (43%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PNPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQ 230
            |.||..|.|:..:...:||          |..:..:|:.|...||..|..::||....|..:|..
 Frog   145 PPPADDAPAVDSSFLSSAS----------KRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKL 199

  Fly   231 LKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSSVPVL-----NLGSGS 290
            |.|::||:|.||||||.|:::.:..|...           |||...|.||.|.|     ||....
 Frog   200 LNLSERQIKIWFQNRRMKFKKDHKGKGGG-----------GSPGGLSPSSSPSLMPYSGNLPLDG 253

  Fly   291 RCGQQ 295
            .||.:
 Frog   254 DCGYE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 21/50 (42%)
hoxc3XP_002936696.1 Homeodomain 164..220 CDD:459649 22/55 (40%)
DUF4074 335..392 CDD:463833
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.