DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrta1

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001072447.1 Gene:dmrta1 / 779901 XenbaseID:XB-GENE-984361 Length:448 Species:Xenopus tropicalis


Alignment Length:297 Identity:87/297 - (29%)
Similarity:135/297 - (45%) Gaps:88/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVED------- 96
            |.||||||||||::|.|:|||:.|.:::|.||||.||.||||:|||||||:||||.|:       
 Frog    79 RTPKCARCRNHGVVSALKGHKRFCRWRDCSCAKCTLIAERQRVMAAQVALRRQQAQEECEVRDVQ 143

  Fly    97 ---------------AIAMRLV---------ANKTGRSIDALPPGNIFGLTVTQPS--------- 128
                           |..::::         :.||.::.:.:|..:||..::.|||         
 Frog   144 HFLYPGGERETPGTRAQTLQIISREENKDETSEKTEQTYERIPTSSIFSHSLPQPSPSGIVNACH 208

  Fly   129 -----SPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAV--------------AQDLSA---- 170
                 .|....:|:.::.:.||        ...|.::||..              .:||||    
 Frog   209 ILKSAGPENSNKDECIQSSGSE--------ERSEGADSPRSLSSCDLESGNECEWPKDLSASSSK 265

  Fly   171 ----PRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIENVSPTGKSSPVDVTS---- 227
                |.|   .:..:::|.::||.:|:|.|:.:|:.|..|:::|||.|. .||....|...    
 Frog   266 IPVVPSR---QRDPLEILRKVFPNQKQSSLQSILQYCKGDVVQAIEFVL-NGKEDKKDAKDTESS 326

  Fly   228 -----NQLPSQEPGMLTTMPQPAPPRSSAFRPVITDQ 259
                 |....:....||.:........|||.|:.|:|
 Frog   327 LGPDRNAFTKESALNLTGLGIGGFGTKSAFSPLHTNQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 12/37 (32%)
dmrta1NP_001072447.1 DM 79..125 CDD:366283 30/45 (67%)
CUE_DMA_DMRTA1 272..311 CDD:270600 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 1 1.000 - - X984
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.