DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrtc2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_017167796.1 Gene:Dmrtc2 / 71241 MGIID:1918491 Length:401 Species:Mus musculus


Alignment Length:343 Identity:91/343 - (26%)
Similarity:131/343 - (38%) Gaps:110/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSSGEPADEVANKRPRLVANPKATKIVEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNC 67
            |:...||||.     |:   |::|:::   |.:..:|.|.||||||||:.:.|:|||:||.::.|
Mouse    44 SADSSPADEA-----RV---PQSTELI---PRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQAC 97

  Fly    68 KCAKCVLIFERQRIMAAQVALKRQQ--AVEDAIAMRLVAN----------KTGRSIDALPPG--N 118
            :|.|||||.||:|:|||||||:|||  .::..:|..|:..          |.|.....:|.|  |
Mouse    98 ECHKCVLILERRRVMAAQVALRRQQEAQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKEN 162

  Fly   119 IFGLTVTQPSSPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPRRDNVSQTAIDM 183
            |    ..||.||..                              ||...|:.|.::|.....:..
Mouse   163 I----APQPQSPHG------------------------------AVPLVLTPPGKENYGPLLLSR 193

  Fly   184 LAQLFPQRKRSVLELVLKRCDLDLIRAIENVSPTGKSSPVDVTSNQLPSQEPGMLTTMPQPAPPR 248
            ..:..|.....|                    |.|...|    .:.||   ||:  :||.|...|
Mouse   194 PPEALPLPWTPV--------------------PPGPWGP----GHWLP---PGL--SMPPPVVCR 229

  Fly   249 SSAFRPVIT-------DQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWFVPLSFPVTMGHLSN 306
            .....|.:.       |...|     |:.|..|...:...:.::...|....|...|       |
Mouse   230 LLCQEPAVPLHPFPGFDPGTS-----LRLPTHGTLPTCPGSRSVLTAPLSGEPQGPP-------N 282

  Fly   307 LAPRCT---LPNCACLDS 321
            |...|:   |.:|...||
Mouse   283 LPHTCSTLILQSCGTPDS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 2/37 (5%)
Dmrtc2XP_017167796.1 DM 69..115 CDD:366283 28/45 (62%)
DMRT-like 273..400 CDD:374115 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.