DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and C18orf63

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001167594.1 Gene:C18orf63 / 644041 HGNCID:40037 Length:685 Species:Homo sapiens


Alignment Length:284 Identity:57/284 - (20%)
Similarity:99/284 - (34%) Gaps:66/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NKRPRLVANPKAT--KIVEPTPAKVTNRVPKCAR----CR---NH-----------GIISEL--- 55
            |.:...|..|..|  |::..:..:.|:|.|.||:    |.   :|           ||.|.|   
Human   324 NIQEHKVKPPNLTTKKMLRASLTQATSRKPACAQSLLPCSVAVDHKVELSVSQPTSGIFSALHLQ 388

  Fly    56 ----RGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRLVANKTGRSIDALPP 116
                :|.||..:.:..:....||:..|.........|..|    ..|..:.|.....|.:.....
Human   389 PESVQGRKKSLSIRAPQVHSEVLMPNRGNTQVQHTNLSSQ----SNITPKFVPVFKNRLLQMNKN 449

  Fly   117 GNIFGLTVTQPSSPRAKREDDQVEKTISEVEQ--QH--------LKQREEEYSESPA---VAQDL 168
            .::.|       ||:.|:.|....|..|....  ||        :|.|.....:..|   :.|:.
Human   450 TSVLG-------SPKRKQHDVTQSKLFSLKTSMIQHDKLNLGPAIKNRYSSNIQMQAANNLNQEN 507

  Fly   169 SAPRRDNVSQTAIDMLAQLFP-QRKRSVLEL------------VLKRCDLDLIRAIENVSPTGKS 220
            |.|.::..::::.:|..  || .|.:|.:.|            |:...:|.::::..:....||.
Human   508 SRPLQEKNTESSENMTK--FPSSRGKSTVSLNKNKQLSNSAVFVVSNNNLGVVKSAVDFQMKGKE 570

  Fly   221 SPVDVTSNQLPSQEPGMLTTMPQP 244
            :.......|:..:..|.|....||
Human   571 NLTGKGITQILGKSHGSLKLKRQP 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 16/70 (23%)
CUE_DMA 176..214 CDD:270553 8/50 (16%)
C18orf63NP_001167594.1 DUF4708 7..280 CDD:292441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..538 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 635..685
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.