Sequence 1: | NP_524428.1 | Gene: | dmrt93B / 42494 | FlyBaseID: | FBgn0038851 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071443.2 | Gene: | DMRTA1 / 63951 | HGNCID: | 13826 | Length: | 504 | Species: | Homo sapiens |
Alignment Length: | 352 | Identity: | 102/352 - (28%) |
---|---|---|---|
Similarity: | 137/352 - (38%) | Gaps: | 132/352 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIA---M 100
Fly 101 RLVANKTGRSIDALPPGN----------------------IFGL--------------TVTQPSS 129
Fly 130 PRAKREDDQ---------VEKTISEVEQQHLKQRE---------------EEYSESP-------- 162
Fly 163 -----------------------------AVAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLEL 198
Fly 199 VLKRCDLDLIRAIENVSPTGKSSPVDVTSNQLPSQEPGMLTTMPQPAPPRS------------SA 251
Fly 252 FRPVITDQYQSKSVVELKPPVFGGSAS 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt93B | NP_524428.1 | DM | 39..85 | CDD:279137 | 30/45 (67%) |
CUE_DMA | 176..214 | CDD:270553 | 14/37 (38%) | ||
DMRTA1 | NP_071443.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
DM | 93..139 | CDD:279137 | 30/45 (67%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 170..192 | 0/21 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 266..307 | 4/40 (10%) | |||
CUE_DMA_DMRTA1 | 325..364 | CDD:270600 | 14/38 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12322 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3693 |
SonicParanoid | 1 | 1.000 | - | - | X984 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.900 |