DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and DMRTC2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_016882612.1 Gene:DMRTC2 / 63946 HGNCID:13911 Length:423 Species:Homo sapiens


Alignment Length:321 Identity:87/321 - (27%)
Similarity:122/321 - (38%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASSSGEPADEVANKRPRL-------VANPKATKIVEPTPAKVTNRVPKCARCRNHGIISELRGH 58
            |...|.||:|..|.....|       ..:|::|:::   |.:..:|.|.||||||||:.:.|:||
Human     1 MRIRSMEPSDMPAGYHCPLDSAPWDETRDPQSTELI---PRRAISRSPTCARCRNHGVTAHLKGH 62

  Fly    59 KKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRLVANKTGRSIDALPPGNIFGLT 123
            |:||.::.|:|.|||||.||:|:|||||||:|||  |..:...|:  :.|.:....|  |.|...
Human    63 KRLCLFQACECHKCVLILERRRVMAAQVALRRQQ--EAQLKKHLM--RRGEASPKAP--NHFRKG 121

  Fly   124 VTQPSSPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPRRDNVSQTAIDMLAQLF 188
            .|||..|..|                                        :|::..         
Human   122 TTQPQVPSGK----------------------------------------ENIAPQ--------- 137

  Fly   189 PQRKRSVLELVLKRCDLDLIRAIENVSPTGKSSPVDVTSNQLPSQEPGMLTTMPQP--------- 244
            ||.....:.|.              .:|.||:|...:..:..|...|  |:..|.|         
Human   138 PQTPHGAVLLA--------------PTPPGKNSCGPLLLSHPPEASP--LSWTPVPPGPWVPGHW 186

  Fly   245 APPRSSAFRPVITDQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWFVPLSFPVTMGHLS 305
            .||..|...||:......:..|.|.|  |.|.....:.......|....|.|.||....||
Human   187 LPPGFSMPPPVVCRLLYQEPAVSLPP--FPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 3/37 (8%)
DMRTC2XP_016882612.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.