DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and DMRT3

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_067063.1 Gene:DMRT3 / 58524 HGNCID:13909 Length:472 Species:Homo sapiens


Alignment Length:452 Identity:112/452 - (24%)
Similarity:161/452 - (35%) Gaps:186/452 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQA 93
            |...|.....|.||||||||||::|.|:|||:.|.:|:|.|.||:||.||||:|||||||:||||
Human    15 VSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQA 79

  Fly    94 VEDAIAMRLVANKTGRSIDAL----PPGNIFGL----TVTQPSSPRAKR---------------- 134
            .|...:  |:.:    |:.||    |||:....    ..:|||.|:..|                
Human    80 NESLES--LIPD----SLRALPGPPPPGDAVAAPQPPPASQPSQPQPPRPAAELAAAAALRWTAE 138

  Fly   135 -----------EDDQVEKTISEVEQ----QHLKQREEEYSESPAVAQD----------------- 167
                       :.|..|:.:.:.:.    :....::.:...||.||:.                 
Human   139 PQPGALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTPESPEIVSVEEG 203

  Fly   168 -----------------------------------LSAPRRDNVSQTAIDMLAQLFPQRKRSVLE 197
                                               :|.|.....::..:::|.::||.:|.:|||
Human   204 GYAVQKNGGNPESRPDSPKCHAEQNHLLIEGPSGTVSLPFSLKANRPPLEVLKKIFPNQKPTVLE 268

  Fly   198 LVLKRCDLDLIRAIE-----NVSPTG------------------------KSSPVDV-------- 225
            |:||.|..||:.|:|     ..|.||                        .|.|:..        
Human   269 LILKGCGGDLVSAVEVLLSSRSSVTGAERTSAEPESLALPSNGHIFEHTLSSYPISSSKWSVGSA 333

  Fly   226 ------------TSNQLPSQEPGMLTTMPQPAPPR-------------SSAFRP---------VI 256
                        :||.:||...|.|.. |.|.|||             ||.|.|         .:
Human   334 FRVPDTLRFSADSSNVVPSPLAGPLQP-PFPQPPRYPLMLRNTLARSQSSPFLPNDVTLWNTMTL 397

  Fly   257 TDQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWFVPLSFPVTMGHLSNLAPRCTLPNCAC 318
            ..|||.:|  :...|....|.|              |..|.||.....:. .||.::|:..|
Human   398 QQQYQLRS--QYVSPFPSNSTS--------------VFRSSPVLPARATE-DPRISIPDDGC 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 15/42 (36%)
DMRT3NP_067063.1 DM 25..71 CDD:279137 30/45 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..128 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..191 5/35 (14%)
CUE_DMA_DMRTA3 247..289 CDD:270602 15/41 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..472 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.