Sequence 1: | NP_524428.1 | Gene: | dmrt93B / 42494 | FlyBaseID: | FBgn0038851 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067063.1 | Gene: | DMRT3 / 58524 | HGNCID: | 13909 | Length: | 472 | Species: | Homo sapiens |
Alignment Length: | 452 | Identity: | 112/452 - (24%) |
---|---|---|---|
Similarity: | 161/452 - (35%) | Gaps: | 186/452 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 VEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQA 93
Fly 94 VEDAIAMRLVANKTGRSIDAL----PPGNIFGL----TVTQPSSPRAKR---------------- 134
Fly 135 -----------EDDQVEKTISEVEQ----QHLKQREEEYSESPAVAQD----------------- 167
Fly 168 -----------------------------------LSAPRRDNVSQTAIDMLAQLFPQRKRSVLE 197
Fly 198 LVLKRCDLDLIRAIE-----NVSPTG------------------------KSSPVDV-------- 225
Fly 226 ------------TSNQLPSQEPGMLTTMPQPAPPR-------------SSAFRP---------VI 256
Fly 257 TDQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWFVPLSFPVTMGHLSNLAPRCTLPNCAC 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt93B | NP_524428.1 | DM | 39..85 | CDD:279137 | 30/45 (67%) |
CUE_DMA | 176..214 | CDD:270553 | 15/42 (36%) | ||
DMRT3 | NP_067063.1 | DM | 25..71 | CDD:279137 | 30/45 (67%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 89..128 | 11/42 (26%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 155..191 | 5/35 (14%) | |||
CUE_DMA_DMRTA3 | 247..289 | CDD:270602 | 15/41 (37%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 430..472 | 4/14 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 140 | 1.000 | Inparanoid score | I4503 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D383821at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12322 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3693 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.960 |