DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrt1

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_030106845.1 Gene:Dmrt1 / 50796 MGIID:1354733 Length:475 Species:Mus musculus


Alignment Length:266 Identity:76/266 - (28%)
Similarity:114/266 - (42%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAI 98
            :|.:.|:||||||||||..|.|:|||:.|.:::|:|.||.||.||||:|||||||:||||.|:.:
Mouse    65 SKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQEEEL 129

  Fly    99 -----------AMRLVANKTGRSIDALPPGNIFGLTVTQPSSPR-AKREDDQVEKTISEVEQQHL 151
                       |..||..:...|...|...|.........|:|. |..|...|.:.|..|..:..
Mouse   130 GISHPIPLPSAAELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASEGRMVIQDIPAVTSRGH 194

  Fly   152 KQREEEYSESPAVAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIE-NVS 215
            .:...:....||.......|              .|||...             :|....: :::
Mouse   195 MENTSDLVSDPAYYSSFYQP--------------SLFPYYN-------------NLYNYPQYSMA 232

  Fly   216 PTGKSSPVDVTSNQLPSQEPGMLTTMPQPAPP---------RSSAFRPVITDQYQSKSVVELKPP 271
            .:.:||..:|.::...|.....|.::|.|..|         ::|..|..::.||:..|.  ..||
Mouse   233 LSAESSSGEVGNSLGGSPVKNSLRSLPAPYVPAQTGNQWQMKTSESRHPVSSQYRMHSY--YGPP 295

  Fly   272 VFGGSA 277
            .:.|.:
Mouse   296 SYLGQS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 29/45 (64%)
CUE_DMA 176..214 CDD:270553 4/38 (11%)
Dmrt1XP_030106845.1 DM 70..116 CDD:366283 29/45 (64%)
Dmrt1 128..200 CDD:372081 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008340
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.