DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrt3a

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001005779.2 Gene:dmrt3a / 450035 ZFINID:ZDB-GENE-021220-3 Length:448 Species:Danio rerio


Alignment Length:354 Identity:104/354 - (29%)
Similarity:146/354 - (41%) Gaps:119/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDA 97
            |.....|.||||||||||::|.|:|||:.|.:|:|.|.||:||.||||:|||||||:||||.|. 
Zfish    18 PRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANES- 81

  Fly    98 IAMRLVANKTGRSIDALPPGNIFGLTVT---QPSSPRAKRED----------------------- 136
                 :.:....|:.|||     |:||:   |.::|||...|                       
Zfish    82 -----LESLIPESLRALP-----GITVSSGEQSANPRASDIDLRWNTETGTPKTPQDLSDELSGE 136

  Fly   137 ---------DQVEKTISEVEQQH------------LKQREE-------------------EYSES 161
                     |:..:.:|..|:..            ..|.||                   :||..
Zfish   137 QSGGENGGSDREPEAVSSPEESKPNLCCTPDTSDPSPQLEESRFGLSKSCSDPEPKSDNPKYSPE 201

  Fly   162 P-----AVAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIE-NVSPTGKS 220
            |     .::..:|.|.....::..:::|.::||..|.:||||:||.|..||:.||| .:|.....
Zfish   202 PNLLIEGLSGSVSLPFSLRANRPPLEVLKKIFPAHKPAVLELILKGCGGDLVGAIEILLSSRSTM 266

  Fly   221 SPVDVTSNQ-----LPSQEPGMLTTMPQPAPPRS-------SAFRPVITDQYQSKSVVELKPPVF 273
            .|..:.|..     |||.  |.|...|..:.|.|       ||||...:.::.|:|        .
Zfish   267 KPEKILSESSDALVLPSN--GHLFEHPLSSYPVSSSKWSVGSAFRVPDSLRFSSES--------S 321

  Fly   274 GGSASAAAAAAICAYPKWFVPLSFPVTMG 302
            ||....              |||.|:..|
Zfish   322 GGVVPG--------------PLSMPLQHG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 16/38 (42%)
dmrt3aNP_001005779.2 DM 24..70 CDD:279137 30/45 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..203 14/104 (13%)
CUE_DMA_DMRTA3 221..263 CDD:270602 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.