DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrtb1

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001178690.1 Gene:Dmrtb1 / 313484 RGDID:1560921 Length:348 Species:Rattus norvegicus


Alignment Length:297 Identity:74/297 - (24%)
Similarity:102/297 - (34%) Gaps:96/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAM--- 100
            |.|||:||||||.:..::||...|.:|:|.|.||.||.|||:|||||..||.|...|....:   
  Rat     3 RTPKCSRCRNHGYLVPVKGHAGKCRWKHCICDKCYLITERQKIMAAQKVLKNQATEEQGATVGTQ 67

  Fly   101 ------------RLVANKTGRSIDALPPGNIFG------LTVTQPSSPRAKREDDQVEKTISEVE 147
                        ...|..:..||..||...:.|      .|.....||:|:              
  Rat    68 GPQLPPRAPAPAAATATASSSSICPLPRAALGGAGPGPAATCFLERSPQAR-------------- 118

  Fly   148 QQHLKQREEEYSESPAVAQDLSAPR------------RDNVSQTAIDMLAQLFPQRKRSVLELVL 200
                       |..|:..|.:.:.|            ...:.......|.||.||..|..|    
  Rat   119 -----------SPGPSAFQLVPSGRPGPSTFQPGSGGSGGLHDRPPAWLPQLRPQAPRPEL---- 168

  Fly   201 KRCDLDL---IRAIENVSPTGKSSPVDVTSNQL-----PSQE-----PGMLTTMP-QPAP----- 246
              |..|.   :|.:..:.......|:...|:.:     |.:|     |..:...| ||.|     
  Rat   169 --CCPDQHLPVRPVPRLPFADYGHPLRFKSDHVVGAGYPEREPFKQCPACIPVPPYQPFPLSEGQ 231

  Fly   247 --------PRSSAFRPVITDQYQSKSVV-----ELKP 270
                    |:...||.|....|...|:|     :|:|
  Rat   232 DSSSALGVPQQRGFRHVSCGPYHGNSLVSEPARDLQP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 26/45 (58%)
CUE_DMA 176..214 CDD:270553 10/40 (25%)
Dmrtb1NP_001178690.1 DM 3..49 CDD:279137 26/45 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.