DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrta2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001101421.2 Gene:Dmrta2 / 313471 RGDID:1308173 Length:536 Species:Rattus norvegicus


Alignment Length:485 Identity:122/485 - (25%)
Similarity:176/485 - (36%) Gaps:194/485 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASSSGEPADEVAN---------KRPRLVAN------PKATKIVEPTPAKVTNRVPKCARCRNHGI 51
            |:::|.|...||:         ..|..||.      |...:..|..|     |.||||||||||:
  Rat    18 ATATGPPVASVASVAAAAAAAASLPVSVAGGLLRAPPLLLRAAEKYP-----RTPKCARCRNHGV 77

  Fly    52 ISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMR---LVANKTGRSIDA 113
            :|.|:|||:.|.:|:|.||||.||.||||:|||||||:||||.|:..|..   |.....|.::.|
  Rat    78 VSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQLLYGTAEGLALAA 142

  Fly   114 ----LPPG---NIFG------------------------------------------LTVTQPSS 129
                :||.   .:||                                          |...:|.|
  Rat   143 ANGIIPPRPAYEVFGSVCATDGGGPGAGAPAGSAGGAGGAGGAEAKLQKFDLFPKTLLQAGRPDS 207

  Fly   130 P--------------------------------------------RAKR---------------- 134
            |                                            ||.:                
  Rat   208 PQPPPGKPLSPDGADSGPGTSSPEVRPGSGSENGDGESFSGSPLARASKEAGGSCPGSAGASGGG 272

  Fly   135 EDDQV-------EKTISEVEQQHLKQREEEYSESPAVAQDLSAPRRDNVSQTAIDMLAQLFPQRK 192
            |:|..       .::.||.:::     |.|.:.:|.:... ..||:    :|.:|:|.::||..:
  Rat   273 EEDSPGSSSPLGSESGSEADKE-----EAEAAPTPGLGGG-PGPRQ----RTPLDILTRVFPGHR 327

  Fly   193 RSVLELVLKRCDLDLIRAIENV---------SPTGKSSPVD--------VTSNQLPSQE------ 234
            |.||||||:.|..|:::|||.|         :..|.::|::        ...:..|.:.      
  Rat   328 RGVLELVLQGCGGDVVQAIEQVLNHHRGGLAAGLGPAAPLEKAAVSAAAAVEDAWPGRVEAAAAG 392

  Fly   235 ----PGMLTTMPQPAPPR-----SSAFRPVITDQYQSKSVVE-LKPPV--FGGSASAAAAAAICA 287
                |..|.|.| .|||.     :.|..|.......|:|... |:|..  ||..|.|....|   
  Rat   393 GAGLPAPLQTGP-AAPPHHRPLLAGAMTPGALGSLSSRSAFSPLQPNASHFGADAGAYPLGA--- 453

  Fly   288 YPKWFVP--LSFPVTMGH---LSNLAPRCT 312
             |....|  |::.....|   |:.:||..|
  Rat   454 -PLGLSPLRLAYSAAAAHSRGLAFMAPYST 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 31/45 (69%)
CUE_DMA 176..214 CDD:270553 17/37 (46%)
Dmrta2NP_001101421.2 DM 65..111 CDD:395608 31/45 (69%)
CUE_DMA_DMRTA2 311..352 CDD:270601 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X984
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.