DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrta1

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001101415.1 Gene:Dmrta1 / 313352 RGDID:1309796 Length:488 Species:Rattus norvegicus


Alignment Length:279 Identity:81/279 - (29%)
Similarity:118/279 - (42%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRL- 102
            |.||||||||||::|.|:|||:.|.:::|.||||.||.||||:|||||||:||||.|::.|..| 
  Rat    80 RTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLH 144

  Fly   103 -------------VANKTGR-----------SIDALPPG--------NIFGLTVTQPSSPRAKRE 135
                         .:..:||           ::.||..|        ::....|.|......|:|
  Rat   145 RLLYQGPSGPGAPASGGSGRTESPQVLSSPMTVAALGAGASRHPGSRSVPAFEVFQQDFAERKQE 209

  Fly   136 DDQV---------EKTISE--------------VEQQHLKQREEEYSESPAV------------- 164
            ..|.         |:.:|.              :|:|.......|.|:...:             
  Rat   210 PKQSNCESCQSRHEEPVSNTHHRSPGSSNGNVTMEKQGFMSSISEQSDKSTIILSPCPTDQSGGE 274

  Fly   165 -------AQDLSAPR-----RDNVSQTA------------IDMLAQLFPQRKRSVLELVLKRCDL 205
                   :.||.:..     ||..:.||            :.:|.::||..|||.||.:|:.|..
  Rat   275 DSPRSFSSSDLESGNESEWARDYTATTASLSTVTSRPRDPLGILTRIFPGYKRSRLEGILQFCKG 339

  Fly   206 DLIRAIENVSPTGKSSPVD 224
            |:::|||.:. .||....|
  Rat   340 DVVQAIEQIL-NGKEHKPD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 16/49 (33%)
Dmrta1NP_001101415.1 DM 80..126 CDD:279137 30/45 (67%)
DMA 313..348 CDD:281472 14/34 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X984
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.