DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrt2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001101067.1 Gene:Dmrt2 / 309430 RGDID:1309047 Length:560 Species:Rattus norvegicus


Alignment Length:382 Identity:96/382 - (25%)
Similarity:142/382 - (37%) Gaps:137/382 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASSSGEPADEVANKR----------------PRLVANPKATKIVE--------PTPAKVTNRVPK 42
            |...||..|..|:..                |...|.|.|..:.|        ..|.|: :|.||
  Rat    57 AEDEGEGEDSSASPEVPGRPEQPGGLAPRPPPAAQALPAAAVVPERGVTAGGGAEPRKL-SRTPK 120

  Fly    43 CARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAM------- 100
            ||||||||::|.|:|||:.|.:::|:||.|:|:.||||:|||||||:||||.||...:       
  Rat   121 CARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNF 185

  Fly   101 --RLVANKTGRSIDALPPGNIFG--------------LTVTQPSSPRAKRE----DDQVEKTISE 145
              :.|..:..|:...|....:.|              |.:..|.|.|.::.    |.::|..:.|
  Rat   186 DRKAVYQRQVRAPSLLAKSILEGYRPMTAAETYLGGTLPLPPPVSDRMRKRRAFADKELENIMLE 250

  Fly   146 VEQQHLKQRE-------------------EEYSE-----SPAVAQDLSAPRRD--NVSQTAIDM- 183
            .|   .|:||                   .|||.     ||:..:   .|.:|  |...|.:|: 
  Rat   251 RE---YKEREMLETSQAAALFLPNRMVPGPEYSSYKGAFSPSAGE---LPSKDFCNFLPTCLDLT 309

  Fly   184 -----------------LAQLFPQRKRSVLELVLKRCD------------LDLIRAIENVSP--- 216
                             :|..:.|...|...||..:|.            |:...:::.:.|   
  Rat   310 MQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQYLLNATTSVQALKPGAG 374

  Fly   217 -----TGKSSPVDVTSNQLPSQEPGMLTTMPQ--------------PAPPRSSAFRP 254
                 |.....:....:.:|.:..|.| .:||              .|.|..|||.|
  Rat   375 WDLKGTRVQDGLSAEHDGMPPKPEGSL-VLPQLSEVPTSRTDLQAHQAVPERSAFSP 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 9/67 (13%)
Dmrt2NP_001101067.1 DM 117..163 CDD:395608 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.