DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrt2a

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_571027.1 Gene:dmrt2a / 30129 ZFINID:ZDB-GENE-990621-7 Length:507 Species:Danio rerio


Alignment Length:301 Identity:86/301 - (28%)
Similarity:125/301 - (41%) Gaps:104/301 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDA----- 97
            :|.||||||||||::|.|:|||:.|.:::|:||.|:|:.||||:|||||||:||||.||.     
Zfish    56 SRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGITG 120

  Fly    98 ---------IAMRLVANKT--GRSI----------------DALPPGNIFGLTVTQPSSPRAKRE 135
                     |..|.:...|  .:||                .||||          |.|.|.::.
Zfish   121 KQIPVERRNIYQRHIRPSTMLAKSILEGYRPVQNDPFLGANPALPP----------PLSDRMRKR 175

  Fly   136 ----DDQVEKTISEVEQQHLKQRE---------------------EEYSESPAVAQDLSAPRRDN 175
                |.::|..:.|.|   .|:||                     .||:.........|||  ..
Zfish   176 RAFADKELETIMLERE---YKERELLESTQSNSASLFMPGSMVHAAEYNSYKTAFSSASAP--ST 235

  Fly   176 VSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIENVSPTGKSSPVDVTSNQLPSQEPGMLTT 240
            |..:..|:..             .|..| |||  :::..:..|.::.|::.|:.:     .:.||
Zfish   236 VEPSPKDLCG-------------FLPGC-LDL--SLQYAATGGTTANVELISSNV-----SVATT 279

  Fly   241 MPQ-PAPPR-------SSAFRPVITDQ---YQSKSVVELKP 270
            ..| |..||       ||:....:..|   ..:.:|..|||
Zfish   280 YRQYPLSPRFVMWPRGSSSISDALLYQQCLLNATAVQNLKP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 7/37 (19%)
dmrt2aNP_571027.1 DM 57..103 CDD:279137 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.