DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and mab-23

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001041089.1 Gene:mab-23 / 266926 WormBaseID:WBGene00003114 Length:175 Species:Caenorhabditis elegans


Alignment Length:191 Identity:44/191 - (23%)
Similarity:78/191 - (40%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VPK----CARCRNHGIISE-LRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIA 99
            :||    |..|.||||.:: .:|||:.|.|:.|.|:.|.|..:|:.:...:..||...       
 Worm     1 MPKEQYMCQLCANHGIFNQPKKGHKQKCPYRTCPCSLCALNTKRRALDQIERQLKHTN------- 58

  Fly   100 MRLVANKTGRSIDALPPGNIFGLTVTQ--PSSPRAKREDDQVEKTISEVEQQHLKQREEEYSESP 162
             ..:..:|..|:.:..|......|..:  |.:|.:.:  |....:||........|       .|
 Worm    59 -EPMTGQTATSMASPTPECPLSPTTPKMTPHTPTSGK--DTFRNSISSSNMAFTVQ-------LP 113

  Fly   163 A--VAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIENVSPTGKSS 221
            |  ..::|...|||:....  :.|.:.||:.....:|.:.|.....:..:.|.:: .|:|:
 Worm   114 ATITKKELKLLRRDDTPLQ--NSLERPFPRSIDEAIETIKKEKMSSIFHSAEMLA-VGESA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 18/49 (37%)
CUE_DMA 176..214 CDD:270553 6/37 (16%)
mab-23NP_001041089.1 DM 6..55 CDD:383022 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.