Sequence 1: | NP_524428.1 | Gene: | dmrt93B / 42494 | FlyBaseID: | FBgn0038851 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_783578.1 | Gene: | Dmrta1 / 242523 | MGIID: | 2653627 | Length: | 490 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 74/269 - (27%) |
---|---|---|---|
Similarity: | 112/269 - (41%) | Gaps: | 93/269 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRL- 102
Fly 103 -------------VANKTGRSIDALPPGNIFGLTV------TQPSS------------------- 129
Fly 130 PRAK-------REDDQVEKTISE----------VEQQHLKQREEEYSESPAV------------- 164
Fly 165 -------AQDLSAPR-----RDNVSQTA------------IDMLAQLFPQRKRSVLELVLKRCDL 205
Fly 206 DLIRAIENV 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt93B | NP_524428.1 | DM | 39..85 | CDD:279137 | 30/45 (67%) |
CUE_DMA | 176..214 | CDD:270553 | 14/49 (29%) | ||
Dmrta1 | NP_783578.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
DM | 82..128 | CDD:279137 | 30/45 (67%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 152..171 | 2/18 (11%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..289 | 10/81 (12%) | |||
DMA | 315..350 | CDD:281472 | 13/34 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12322 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3693 |
SonicParanoid | 1 | 1.000 | - | - | X984 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
7 | 6.900 |