DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrta1

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_783578.1 Gene:Dmrta1 / 242523 MGIID:2653627 Length:490 Species:Mus musculus


Alignment Length:269 Identity:74/269 - (27%)
Similarity:112/269 - (41%) Gaps:93/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRL- 102
            |.||||||||||::|.|:|||:.|.:::|.||||.||.||||:|||||||:||||.|::.|..| 
Mouse    82 RTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLH 146

  Fly   103 -------------VANKTGRSIDALPPGNIFGLTV------TQPSS------------------- 129
                         .:..:||:.......|...:.|      ..|.|                   
Mouse   147 RLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVAVLGAGASRHPGSRSVPTFEVFQQDYADRKQE 211

  Fly   130 PRAK-------REDDQVEKTISE----------VEQQHLKQREEEYSESPAV------------- 164
            |:.:       |:::.|..|...          ||:|.......|:.:...:             
Mouse   212 PKQRNCESCQSRQEEPVSNTHHHSLGSSKGNVTVEKQGFMSSIPEHPDKSTIILSPCPTDQSGGE 276

  Fly   165 -------AQDLSAPR-----RDNVSQTA------------IDMLAQLFPQRKRSVLELVLKRCDL 205
                   :.||.:..     ||.::..|            :.:|.::||..|.|.||.:|:.|..
Mouse   277 DSPRSFSSSDLESGNESEWARDYIATRASLSTVTSRPRDPLGILTRIFPGYKHSRLEGILQFCKG 341

  Fly   206 DLIRAIENV 214
            |:::|||.:
Mouse   342 DVVQAIEQI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 14/49 (29%)
Dmrta1NP_783578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
DM 82..128 CDD:279137 30/45 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..171 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..289 10/81 (12%)
DMA 315..350 CDD:281472 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 1 1.000 - - X984
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.