DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and Dmrt3

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_796334.2 Gene:Dmrt3 / 240590 MGIID:2449470 Length:476 Species:Mus musculus


Alignment Length:455 Identity:107/455 - (23%)
Similarity:156/455 - (34%) Gaps:188/455 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQA 93
            |...|.....|.||||||||||::|.|:|||:.|.:|:|.|.||:||.||||:|||||||:||||
Mouse    15 VSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQA 79

  Fly    94 VEDAIAMRLVANKTGRSIDAL----PPGNIFGLTVT------------QPSSPRAKRE------- 135
            .|...:  |:.:    |:.||    |||:......|            .|:.||...|       
Mouse    80 NESLES--LIPD----SLRALPGPPPPGDAAATAATASQSSPASQASQPPAPPRPTAELAAAAAL 138

  Fly   136 -----------------DDQVEKTISEVEQ-----QHLKQREEEYSESPAVAQD----------- 167
                             .|..|:.:.:...     :....::.:...||.|.:.           
Mouse   139 RWVAEPQPGTLPAQLAKPDLTEERVGDSSSTDNTAEAFSDKDTDQRSSPDVVKSKNCFTPESPEI 203

  Fly   168 -----------------------------------------LSAPRRDNVSQTAIDMLAQLFPQR 191
                                                     :|.|.....::..:::|.::||.:
Mouse   204 VSVDEGGYAVQKNGGNPESCPDSPKYHAEQSHLLIEGPSGTVSLPFSLKANRPPLEVLKKIFPNQ 268

  Fly   192 KRSVLELVLKRCDLDLIRAIE-NVSPTGKSSPVDVTSNQ---LPSQ------------------- 233
            |.:||||:||.|..||:.|:| .:|....::..:.|:.:   |||.                   
Mouse   269 KPTVLELILKGCGGDLVSAVEVLLSSRSSAAGAERTAEESLVLPSSGHIFEHTLGSYPISSSKWS 333

  Fly   234 --------------------EPGMLTT---MPQPAPPR-------------SSAFRP-------- 254
                                .|..|..   .|.|.|||             ||.|.|        
Mouse   334 VGSAFRVPDTLRFSADSSNVVPNPLAVPLQHPFPQPPRYPLMLRNTLARNQSSPFLPNDVTLWNT 398

  Fly   255 -VITDQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWFVPLSFPVTMGHLSNLAPRCTLPNCAC 318
             .:..|||.:|  :...|....|.|              |..|.||.....:. .||.::|:..|
Mouse   399 MTLQQQYQLRS--QYVSPFPSNSTS--------------VFRSSPVLSSRTTE-DPRISIPDDGC 446

  Fly   319  318
            Mouse   447  446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 15/38 (39%)
Dmrt3NP_796334.2 DM 25..71 CDD:366283 30/45 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..130 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..195 5/47 (11%)
CUE_DMA_DMRTA3 253..295 CDD:270602 16/41 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..476 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.910

Return to query results.
Submit another query.