DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmd-9

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_500305.1 Gene:dmd-9 / 190512 WormBaseID:WBGene00022060 Length:254 Species:Caenorhabditis elegans


Alignment Length:294 Identity:63/294 - (21%)
Similarity:106/294 - (36%) Gaps:80/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ANPKATKIVEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQ 85
            |..||.|       |:|     |.:|..||..:.|:||..:|.||:|.|..|..:..    |.|.
 Worm    21 AQKKAMK-------KLT-----CRKCEGHGTYAILKGHAGVCPYKDCSCGTCASVMS----MRAN 69

  Fly    86 VALKR---QQAVEDAIAMRLVANKTGRSIDALPPGNIFGLTVTQPSSPRAKREDDQVEKTISEVE 147
            ..::|   :|..:....::.:.:|.|.....:.|.|               .|:..||...:.|.
 Worm    70 ALIRRFRHRQPDQSMAVVKALRSKNGNMRLRIVPRN---------------DEETVVENDGTLVT 119

  Fly   148 QQHLKQREEEYSESPAVAQDL--SAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRA 210
            ....|...:.|:.:...:..:  |...||:|..|.........|....   .|::...|:|:.  
 Worm   120 YSSDKNGHQTYTTTTRRSSIMTNSTDDRDSVVSTPPSTTNNSTPSGSP---PLLVPYGDVDIA-- 179

  Fly   211 IENVSPTGKSSPVDVTS-------NQL---PSQ-EPGMLTTMPQPAPPRSSAFRPVITDQYQSKS 264
               |.|.|.::...:|:       ||:   |:. .|.:::.:.||.  :..:|.|         |
 Worm   180 ---VDPVGAANWEQITNIVRTTMLNQILMNPTNVSPALISFLLQPT--QQPSFEP---------S 230

  Fly   265 VVELKPPVFGGSASAAAAAAICAYPKWFVPLSFP 298
            .:.|.|||.              :|.:...||.|
 Worm   231 TMSLAPPVL--------------FPTFLNGLSVP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 14/45 (31%)
CUE_DMA 176..214 CDD:270553 6/37 (16%)
dmd-9NP_500305.1 DM 27..79 CDD:214606 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.