DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmd-3

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001256882.1 Gene:dmd-3 / 189878 WormBaseID:WBGene00012832 Length:250 Species:Caenorhabditis elegans


Alignment Length:143 Identity:42/143 - (29%)
Similarity:67/143 - (46%) Gaps:27/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSGEPADEVANKRPRLVANPKATKIVEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCK 68
            ||||..|:         ..||             .|.|.|.||..|.:::.|:|||:.|.:::|.
 Worm   100 SSGEDKDD---------GKPK-------------ERRPNCQRCAQHSVVNRLKGHKRACPFRDCF 142

  Fly    69 CAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRLVANKTGRSIDALPPGNIFGLTVTQPSSPRAK 133
            ||||.::.|||::||.|:.|:|:|..|   ...|.:.:......::.|..|.  |||..::|.::
 Worm   143 CAKCQVVVERQKLMADQIKLRRRQKRE---KNNLNSEREAPIAHSMTPSPID--TVTTTTTPTSE 202

  Fly   134 REDDQVEKTISEV 146
            .......|...:|
 Worm   203 TSTPMCLKCAQQV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 21/45 (47%)
CUE_DMA 176..214 CDD:270553
dmd-3NP_001256882.1 DM 15..60 CDD:366283
DM 113..166 CDD:214606 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.