DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmd-8

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_503176.2 Gene:dmd-8 / 188771 WormBaseID:WBGene00020708 Length:369 Species:Caenorhabditis elegans


Alignment Length:339 Identity:70/339 - (20%)
Similarity:120/339 - (35%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPK-----CARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAI 98
            |:||     |..|:.||:..|.|||  .|.|::|:|.:|.|:.:|:.||:.|:.|:|:|      
 Worm    42 RIPKDVKRHCGMCKQHGVFVETRGH--TCEYRSCECEQCDLVRKRREIMSTQIRLRREQ------ 98

  Fly    99 AMRLVANKTGRSIDALPPGNIF-GLTVTQPSSPRA----------------------KREDDQVE 140
                  :|..:..:.:...|:| |.|..:......                      |....:.:
 Worm    99 ------DKKFQRTNDISEANVFPGFTGGEADEKAVMENMNMCYFCQKCKNHNVLVWKKNHKKECQ 157

  Fly   141 KTISEVEQ-----------QHLKQRE----------------EEYSESPAVAQDLSAPRRDNVSQ 178
            .:..|.:|           :|:|:|:                ::...:.|.:..||:....|..:
 Worm   158 YSSCECQQCNLIDSRRALDRHIKKRKMSIKGNTVEAIAPKSPKKEGSTTASSSSLSSSSGCNSDE 222

  Fly   179 TAID-------MLAQLFPQRKRSVLELVLKRCDLD----LIRAI--ENVSPTGKSSPVDVTSNQL 230
            :|..       ||::     |.::...|..:.|..    :|.|.  .|.|.:...||.:.|| .:
 Worm   223 SASSSDCSLSGMLSE-----KLNMAPQVQMKFDFSAGGFMIPAATSANASTSPAGSPFETTS-PM 281

  Fly   231 PSQEPGMLTTMPQPAP---PRSSAFRPVITDQYQSKSVVELKPPVFGGSASAAAAAAICAYPKWF 292
            |...|.....:||.||   |.|....|.:.....|        |.|.......||..:...|...
 Worm   282 PLLLPHSPIALPQLAPSSLPLSFLTVPSLMSTAAS--------PFFTAPLMYGAAPTLFPNPLLM 338

  Fly   293 VPLSFPVTMGHLSN 306
            .|:...:...:..|
 Worm   339 TPIGMQMLFQNFQN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 20/50 (40%)
CUE_DMA 176..214 CDD:270553 8/50 (16%)
dmd-8NP_503176.2 DM 47..98 CDD:214606 20/52 (38%)
DM 133..186 CDD:214606 6/52 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.