DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmd-5

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_495138.2 Gene:dmd-5 / 184287 WormBaseID:WBGene00017326 Length:280 Species:Caenorhabditis elegans


Alignment Length:319 Identity:88/319 - (27%)
Similarity:130/319 - (40%) Gaps:84/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NPKATKIVEPTP--------AKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFER 78
            :|.:..::.||.        |:...|.||||||||||..|.|:|||:.|.:|:|.||||.||.||
 Worm     4 SPSSVSVLPPTSLEQILRIRAERNQRTPKCARCRNHGTTSALKGHKRYCQWKDCMCAKCTLIAER 68

  Fly    79 QRIMAAQVALKRQQAVE--DAIAMRLVANKTGRSID-----ALPPGNIFGLTVTQPSSPRAKRED 136
            ||:|||||||:|||:.|  ||..:.::....|.:.|     .|..|...|.....|::       
 Worm    69 QRVMAAQVALRRQQSQEERDARDLEVLLGSAGNANDLLDILRLDAGEHHGKNHASPTT------- 126

  Fly   137 DQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLK 201
                        .:....||:|.:|..   ..|:|.....|:|.:                    
 Worm   127 ------------NNNNNTEEKYEDSQG---QRSSPSSPTGSETVV-------------------- 156

  Fly   202 RCDLDLIRAIENVSPTGKSSPVDVTSNQLPSQEPGMLTTMPQPAPPRSSA---FRPVITDQYQSK 263
                            ..|||.:::|...|:....::.|.|...|...|:   |.||....:...
 Worm   157 ----------------STSSPPELSSESTPNTSGSVIPTSPVFKPNGYSSMPMFNPVYGRPFMRF 205

  Fly   264 SVVELKPPVFG--GSASAAAAAAICAYPKWFVPLSFPVTMGHLSNLAPRCTLPNCACLD 320
            .:..:.|..||  ..:..|:||::.|.|.:|   |...|   ::..:|....|..|.||
 Worm   206 PMFSVMPHFFGTPSMSDFASAASLAAPPAFF---SAQPT---IATSSPSTIFPQTAPLD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 31/45 (69%)
CUE_DMA 176..214 CDD:270553 2/37 (5%)
dmd-5NP_495138.2 DM 29..75 CDD:366283 31/45 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.