Sequence 1: | NP_524428.1 | Gene: | dmrt93B / 42494 | FlyBaseID: | FBgn0038851 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379162.1 | Gene: | dmd-10 / 183202 | WormBaseID: | WBGene00007929 | Length: | 348 | Species: | Caenorhabditis elegans |
Alignment Length: | 252 | Identity: | 57/252 - (22%) |
---|---|---|---|
Similarity: | 96/252 - (38%) | Gaps: | 70/252 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 VANPKATKIV---EPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRI 81
Fly 82 MAAQVALKRQQAVEDAIAMR---------------------------------LVANKTGRSIDA 113
Fly 114 LPPGNIF--GLTVTQPS----SPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPR 172
Fly 173 RDNVSQTAIDMLAQLFPQRKRSVLEL-------VLKRCDLDLIRAIENVSPTGKSSP 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt93B | NP_524428.1 | DM | 39..85 | CDD:279137 | 23/45 (51%) |
CUE_DMA | 176..214 | CDD:270553 | 10/44 (23%) | ||
dmd-10 | NP_001379162.1 | DM | 39..92 | CDD:214606 | |
DM | 115..168 | CDD:214606 | 25/52 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.770 |