DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmd-10

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001379162.1 Gene:dmd-10 / 183202 WormBaseID:WBGene00007929 Length:348 Species:Caenorhabditis elegans


Alignment Length:252 Identity:57/252 - (22%)
Similarity:96/252 - (38%) Gaps:70/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VANPKATKIV---EPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRI 81
            :.|...:|::   :....|...|||.|.:|..||..|.|:|||:.|.::.|.||||.::.|||::
 Worm    93 IENENDSKLIIVEDDDKKKQGERVPNCQKCGQHGRKSRLKGHKRSCPFRECPCAKCAVVSERQKL 157

  Fly    82 MAAQVALKRQQAVEDAIAMR---------------------------------LVANKTGRSIDA 113
            ||.|:.::|:|..:..:...                                 |:::.|.....:
 Worm   158 MADQIKIRRRQRKDTLLTFAKNSITSTMFPSNQISLNALNSLLYGSINTSPQPLLSSPTSSDASS 222

  Fly   114 LPPGNIF--GLTVTQPS----SPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPR 172
            ..|...|  .:.:..|:    ||..:.....:..:|:              |.||.:.   |.|.
 Worm   223 CSPSMPFTPSIPMFMPTSADCSPTTQTPTSSIPSSIA--------------STSPLMT---SLPL 270

  Fly   173 RDNVSQTAIDMLAQLFPQRKRSVLEL-------VLKRCDLDLIRAIENVSPTGKSSP 222
            |    .:...:|....|..:.|:|.|       .|.:..||..|.:|..|.:..|||
 Worm   271 R----LSGFPLLNIRDPSAEASLLNLGCNADAAALLKTILDQYRMLEEASMSMSSSP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 23/45 (51%)
CUE_DMA 176..214 CDD:270553 10/44 (23%)
dmd-10NP_001379162.1 DM 39..92 CDD:214606
DM 115..168 CDD:214606 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.