DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrt3

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001243149.1 Gene:dmrt3 / 100495546 XenbaseID:XB-GENE-995121 Length:449 Species:Xenopus tropicalis


Alignment Length:312 Identity:93/312 - (29%)
Similarity:137/312 - (43%) Gaps:86/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDA 97
            |.....|.||||||||||::|.|:|||:.|.:|:|.|.||:||.||||:|||||||:||||.|  
 Frog    18 PRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANE-- 80

  Fly    98 IAMRLVANKTGRSIDALP-------------PGNIFGLTVTQ---PSSPRAKRED---------- 136
             ::..:...|.|::..|.             ||.| |:..||   ||.|.:.:.|          
 Frog    81 -SLESLIPDTLRAVPGLTSSLATDTAQQPGRPGEI-GIRWTQEAPPSLPLSVKADLAEERMGDSS 143

  Fly   137 -DQVEKTISEVEQQHLKQREEE---YSESPAVAQ------------------------------- 166
             .:..:|.|:.:.:|....|.:   ..:||.|..                               
 Frog   144 GTEAGETYSDKDAEHRSSPEGKPCCTPDSPEVVPVAEAGYPGQKSCSTTDSTTDSSKYPEEQGHL 208

  Fly   167 -------DLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIE-----NVSPTGK 219
                   .:|.|.....::..:::|.::||.:|.:||||:||.|..||:.|:|     ..|..|:
 Frog   209 VIEGATGTVSLPFNLKANRPPLEVLKKIFPSQKPTVLELILKGCGGDLVGAVEVLLSSRSSVAGE 273

  Fly   220 SSPVDVTSNQLPSQEPGMLTTMPQPAPPRS-------SAFRPVITDQYQSKS 264
            .:..:..|..||..  |.|......:.|.|       ||||...|.::.:.|
 Frog   274 RTAPEPESIVLPHN--GHLFEHTLSSYPLSSSKWSVGSAFRVPDTLRFSADS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 30/45 (67%)
CUE_DMA 176..214 CDD:270553 15/42 (36%)
dmrt3NP_001243149.1 DM 24..70 CDD:279137 30/45 (67%)
CUE_DMA_DMRTA3 225..267 CDD:270602 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12101
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.