DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and LOC100359752

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_038953287.1 Gene:LOC100359752 / 100359752 RGDID:2323488 Length:735 Species:Rattus norvegicus


Alignment Length:132 Identity:28/132 - (21%)
Similarity:51/132 - (38%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PSSPRAKREDDQVEKTISEVEQQHLKQREEEYSESPAVAQDLSAPR------------------- 172
            |..|..||:.:||.|.:|.:..  ||:::..::|...:||:..|.:                   
  Rat   477 PFIPVFKRKSEQVNKNVSALST--LKRKQSGFTEPTTLAQETGATQGGKPSLGAATRKRPNSNIR 539

  Fly   173 --RDNVSQTAIDML----AQLFPQRKRSVLE-----LVLKRCDLDLIRAIENVSPTGKSSPVDVT 226
              ..|:||.....|    .:.:.::|...|.     :.|:.......||   |:.|.::|...|.
  Rat   540 VLAGNLSQKGSKPLQEKGTEFYDRKKEQPLSDLRQTVHLREARPSCTRA---VTQTSRNSVAGVK 601

  Fly   227 SN 228
            :|
  Rat   602 NN 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137
CUE_DMA 176..214 CDD:270553 8/46 (17%)
LOC100359752XP_038953287.1 DUF4708 50..323 CDD:406292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.