DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrta2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001096543.1 Gene:dmrta2 / 100125187 XenbaseID:XB-GENE-997963 Length:437 Species:Xenopus tropicalis


Alignment Length:316 Identity:103/316 - (32%)
Similarity:141/316 - (44%) Gaps:95/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMR-- 101
            |.||||||||||::|.|:|||:.|.:|:|.||||.||.||||:|||||||:||||.|:..|..  
 Frog    45 RTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 109

  Fly   102 -LVANKTGRSIDA----LPPG---NIFGLTVTQ-------------------------------- 126
             |.....|.::.|    :||.   .:||...|:                                
 Frog   110 LLYGTAEGLALAAANGIIPPRPAYEVFGSVCTEGGTDSKIQKFDLFPKSLIPRSVTPQLSSGGKP 174

  Fly   127 --------------PSSPRAK----REDDQVEKTISEVEQQHLKQREEEYSE-SPAVAQDLSAPR 172
                          .|||.|:    .|:...|..:|....:.||:.||..|. ||..::..|...
 Frog   175 VSPDSESVSGSAPGASSPEARPGSGSENGDGESLLSSPISKALKEGEESPSSISPLGSESGSDAE 239

  Fly   173 RDNV---------SQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIENV-SPTGKSSPVDVTS 227
            :|..         .:|.||:|.::||.:|||||||||:.|..|:::|||.: :..|:....:..|
 Frog   240 KDEQDPSSSSSARQRTPIDILTRVFPAQKRSVLELVLQGCGGDVVQAIEQILNNRGQDKSEETWS 304

  Fly   228 NQ--LPSQEPGMLTTMPQPAPPRSSAFRPVITDQYQSKSVVELKPPVFG--GSASA 279
            ..  |||.:|.:           ||..||:|....         .|..|  ||.||
 Frog   305 RDGALPSIQPSV-----------SSTHRPLIAGAL---------TPAIGTLGSRSA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 31/45 (69%)
CUE_DMA 176..214 CDD:270553 20/46 (43%)
dmrta2NP_001096543.1 DM 45..91 CDD:366283 31/45 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..254 16/90 (18%)
CUE_DMA_DMRTA2 252..293 CDD:270601 20/40 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..317 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12101
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 1 1.000 - - X984
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.