DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt93B and dmrt2

DIOPT Version :9

Sequence 1:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001093726.1 Gene:dmrt2 / 100101749 XenbaseID:XB-GENE-876152 Length:528 Species:Xenopus tropicalis


Alignment Length:373 Identity:88/373 - (23%)
Similarity:140/373 - (37%) Gaps:146/373 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVED------ 96
            :|.||||||||||::|.|:|||:.|.:::|:||.|:|:.||||:|||||||:||||.||      
 Frog    92 SRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSA 156

  Fly    97 --AIAMR------------LVANKTGRSIDALPPGNIFGLTVTQPSSPRAKREDDQVEKTISEVE 147
              :||.|            |:|...   ::...|........|.|..|....:..:..:..::.|
 Frog   157 KPSIAERKPVYQRHIRPPSLLAKSI---LEGYRPVQTDSYLGTSPPLPAQVSDRMRKRRAFADKE 218

  Fly   148 QQHL------KQRE-------------------EEYSESPAV--AQDLSAPRRD--NVSQTAIDM 183
            .:|:      |:||                   .||:...|.  ......|.:|  |...|.:|:
 Frog   219 LEHIMLEREFKEREMLEATQAAGLFLPNRMVHAAEYNSYKAAYGPPQADVPNKDFCNFLPTCLDL 283

  Fly   184 LAQL---------------------FPQRKRSVL---------ELVLKRCDLDLIRAIENVSP-- 216
            ..|.                     :|...|.::         .|:.::|.|: ..|::.:.|  
 Frog   284 TMQYSGSGNMELISSNVSVATTYRQYPVPSRFLVWPKTGPISDALLYQQCLLN-ATAMQALKPGP 347

  Fly   217 --TGKSSPVDVTSNQLPSQE----PGMLT-----------TMPQP-------APPRS-------- 249
              ..||:||   |...||:.    |..:.           ::||.       :||:.        
 Frog   348 NWDSKSNPV---SECQPSEHDLLAPSKIDNPILHPQNDYGSLPQDNAERSAFSPPKRNFPLISSK 409

  Fly   250 --------------------------SAFRPVITDQYQSKSVVELKPP 271
                                      :.|..::...:..||:.:||||
 Frog   410 DHLSAQDSLMNKISKEVTKQPHSLKYNPFHALLQQAHLEKSLEDLKPP 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 9/67 (13%)
dmrt2NP_001093726.1 DM 93..139 CDD:307066 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.