Sequence 1: | NP_524427.1 | Gene: | r-l / 42493 | FlyBaseID: | FBgn0003257 | Length: | 493 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013601.1 | Gene: | URA5 / 854865 | SGDID: | S000004574 | Length: | 226 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 208 | Identity: | 55/208 - (26%) |
---|---|---|---|
Similarity: | 98/208 - (47%) | Gaps: | 38/208 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 EINAFKFGDFKMKVGINSPVYFDLRVIVSYPDVMQTVSDLLVEH---IKDKQLSAKHVCGVPYTA 79
Fly 80 LPLATIVSVQ---------QGTPMLVRRKEAKAYGTKKLVEGIFNAGDTCLIVEDVVTSGSSI-- 133
Fly 134 -LDTVRDLQGEGIVVTDAVVVVDREQ----------GGVANIA-KHGVRMHSLFTLSFLLNTLHE 186
Fly 187 AGRI---EKSTVE 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
r-l | NP_524427.1 | PRTases_typeI | 1..202 | CDD:294217 | 55/208 (26%) |
OMPdecase | 258..479 | CDD:278637 | |||
URA5 | NP_013601.1 | pyrE | 14..199 | CDD:129436 | 47/187 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0461 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.88686 | Normalized mean entropy | S1042 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100519 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1047 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.690 |