DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r-l and URA5

DIOPT Version :9

Sequence 1:NP_524427.1 Gene:r-l / 42493 FlyBaseID:FBgn0003257 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_013601.1 Gene:URA5 / 854865 SGDID:S000004574 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:55/208 - (26%)
Similarity:98/208 - (47%) Gaps:38/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EINAFKFGDFKMKVGINSPVYFDLRVIVSYPDVMQTVSDLLVEH---IKDKQLSAKHVCGVPYTA 79
            |..|.:||.||:|.|..||.:|:|.:.    :..:.:|:|...:   |....|....:.|..|..
Yeast    18 ECQALRFGSFKLKSGRESPYFFNLGLF----NTGKLLSNLATAYAIAIIQSDLKFDVIFGPAYKG 78

  Fly    80 LPLATIVSVQ---------QGTPMLVRRKEAKAYGTKKLVEGIFNAGDTCLIVEDVVTSGSSI-- 133
            :|||.||.|:         |.......|||||.:|...::.|........||::||:|:|::|  
Yeast    79 IPLAAIVCVKLAEIGGSKFQNIQYAFNRKEAKDHGEGGIIVGSALENKRILIIDDVMTAGTAINE 143

  Fly   134 -LDTVRDLQGEGIVVTDAVVVVDREQ----------GGVANIA-KHGVRMHSLFTLSFLLNTLHE 186
             .:.:.:.:|:   |..:::.:||::          .....:: |:|:.:.|:.:|..::..|. 
Yeast   144 AFEIISNAKGQ---VVGSIIALDRQEVVSTDDKEGLSATQTVSKKYGIPVLSIVSLIHIITYLE- 204

  Fly   187 AGRI---EKSTVE 196
             |||   |||.:|
Yeast   205 -GRITAEEKSKIE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r-lNP_524427.1 PRTases_typeI 1..202 CDD:294217 55/208 (26%)
OMPdecase 258..479 CDD:278637
URA5NP_013601.1 pyrE 14..199 CDD:129436 47/187 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.88686 Normalized mean entropy S1042
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100519
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1047
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.