DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r-l and R12E2.11

DIOPT Version :9

Sequence 1:NP_524427.1 Gene:r-l / 42493 FlyBaseID:FBgn0003257 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_491317.1 Gene:R12E2.11 / 172008 WormBaseID:WBGene00020036 Length:227 Species:Caenorhabditis elegans


Alignment Length:186 Identity:81/186 - (43%)
Similarity:120/186 - (64%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFEINAFKFGDFKMKVGINSPVYFDLRVIVSYPDVMQTVSDLLVEHIKDKQLSAKHVCGVPYTAL 80
            |:::..|:.|:|.:|.|..:|:|.|||.|:|.|.|::..:..:.|.|....|...:|.||||.||
 Worm    37 LYQMECFRTGEFYLKSGQMTPIYIDLRRIMSSPRVLRMAAQAMCEKIVASNLKFDYVVGVPYAAL 101

  Fly    81 PLATIVSVQQGTPMLVRRKEAKAYGTKKLVEGIFNAGDTCLIVEDVVTSGSSILDTVRDLQGEGI 145
            ||||:||.....|||::||||||||||:|:||::..|.|.|:||||||||.||.:|...::.|.:
 Worm   102 PLATLVSDILNVPMLMKRKEAKAYGTKQLIEGVYQPGGTVLLVEDVVTSGESIRETAEAIRNENL 166

  Fly   146 VVTDAVVVVDREQGGVANIAKHGVRMHSLFTLSFLLNTLHEAGRIEKSTVEAVAKY 201
            :||||:.|:||:||..||:|:..:...|..|:..:|:     |.|.|:.:....|:
 Worm   167 LVTDAIAVLDRQQGATANLAEDNLNFLSFLTMEKILD-----GLITKNEMTEERKH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r-lNP_524427.1 PRTases_typeI 1..202 CDD:294217 81/186 (44%)
OMPdecase 258..479 CDD:278637
R12E2.11NP_491317.1 PyrE 32..221 CDD:223537 81/186 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I3812
eggNOG 1 0.900 - - E1_COG0461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.88686 Normalized mean entropy S1042
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1303452at2759
OrthoFinder 1 1.000 - - FOG0003431
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1047
SonicParanoid 1 1.000 - - X2793
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.